PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_018786-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 290aa    MW: 32752.8 Da    PI: 5.3061
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_018786-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.42.8e-072960132
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg 32
                     +g+WT+eEd ll ++++++G g W +++ + g
    NNU_018786-RA 29 KGAWTEEEDILLRKCIERYGEGMWCKVPLRAG 60
                     79********************9999987776 PP

2Myb_DNA-binding32.91.4e-1064107246
                      SSS-HHH.HHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteE.dellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +T +E d+++ ++ k+lG++ W++Ia +++ gRt++++k++ ++
    NNU_018786-RA  64 GEFTIDEvDLIIRQLYKLLGNR-WSLIAGRLP-GRTANDVKNYCNT 107
                      5556555366778999999999.*********.**********886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.21E-1426104IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-82657IPR009057Homeodomain-like
SMARTSM007173.9E-1228111IPR001005SANT/Myb domain
PfamPF002494.1E-62962IPR001005SANT/Myb domain
CDDcd001675.79E-831109No hitNo description
PROSITE profilePS5129414.89358113IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.7E-1458111IPR009057Homeodomain-like
PfamPF002497.7E-963107IPR001005SANT/Myb domain
PROSITE profilePS500905.761243273IPR017877Myb-like domain
PfamPF139215.6E-5248286No hitNo description
Gene3DG3DSA:1.10.10.607.1E-9248290IPR009057Homeodomain-like
SuperFamilySSF466899.79E-6249286IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MDLVGWWHCS MQNKTPSSEV MDGGLGLRKG AWTEEEDILL RKCIERYGEG MWCKVPLRAG  60
IKRGEFTIDE VDLIIRQLYK LLGNRWSLIA GRLPGRTAND VKNYCNTRLG KNNLAPKKEE  120
KANTTVEKIK AIRPLPRNFS KSSRWFRPLA DPTSCEGATS QSANKTISNN STTVGTNNQS  180
REIPNEASPD LPPPADDLMQ WWKSVLDETD EMEMETSCPI ISGLAVEEQP ATTEGGNTNV  240
EAGNTTDGHE WDDLSFRLNR YQKSCRLRWL NYLRPGINRG EFTSDEVDLI
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010274760.10.0PREDICTED: transcription factor MYB113-like
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66370.12e-38myb domain protein 113